Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

HGSNAT, Rabbit, Polyclonal Antibody, Abnova™

Rabbit polyclonal antibody raised against recombinant HGSNAT.

Manufacturer:  Abnova Corporation PAB22309

Catalog No. 89-124-016


Add to cart

Description

Description

This gene encodes a lysosomal acetyltransferase, which is one of several enzymes involved in the lysosomal degradation of heparin sulfate. Mutations in this gene are associated with Sanfilippo syndrome C, one type of the lysosomal storage disease mucopolysaccaridosis III, which results from impaired degradation of heparan sulfate. [provided by RefSeq

Sequence: QALLLIHNELLWTNLTVYWKSECCYHCLFQVLVNVPQSPKAGKPSAAAASVSTQHGSILQLNDTLEEKEVCRLEYRFGEFGNYSLLVKNIHNGVSEIACDLAVN
Specifications

Specifications

HGSNAT
Unconjugated
Immunohistochemistry (1:200-1:500) Western Blot (1:250-1:500) The optimal working dilution should be determined by the end user.
HGSNAT
DKFZp686G24175|FLJ22242|FLJ32731|HGNAT|MPS3C|TMEM76
Rabbit
IgG
100 uL
Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Polyclonal
Human
Immunohistochemistry (PFA fixed), Western Blot
Rabbit polyclonal antibody raised against recombinant HGSNAT.
In PBS, pH 7.5 (40% glycerol, 0.02% sodium azide)
Liquid
HGSNAT
Recombinant protein corresponding to amino acids of human HGSNAT.
Antigen affinity purification
RUO
Primary
138050
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

For Research Use Only