HIVEP3, Rabbit, Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-123-625	100 μL

Catalog No. 89-123-625 Supplier Abnova Corporation Supplier No. PAB21918

Description

Rabbit polyclonal antibody raised against recombinant HIVEP3.

Members of the ZAS family, such as ZAS3 (HIVEP3), are large proteins that contain a ZAS domain, a modular protein structure consisting of a pair of C2H2 zinc fingers with an acidic-rich region and a serine/threonine -rich sequence. These proteins bind specific DNA sequences, including the kappa-B motif (GGGACTTTCC), in the promoters and enhancer regions of several genes and viruses, including human immunodeficiency virus (HIV). ZAS genes span more than 150kb and contain at least 10 exons, one of which is longer than 5.5kb (Allen and Wu, 2004).[supplied by OMIM

Sequence: SYSFDDHITDSEALSRSSHVFTSHPRMLKRQPAIELPLGGEYSSEEPGPSSKDTASKPSDEVEPKESELTKKTKKGLKTKGVIYECNICGARYKKRDNYEAHKKYYCSELQIAKPISAGTHTSPEAEKSQIEHEPWSQMMHYKLGTTL

Specifications

• Antigen: HIVEP3
• Applications: Immunohistochemistry (PFA fixed)
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Rabbit polyclonal antibody raised against recombinant HIVEP3.
• Dilution: Immunohistochemistry (1:50-1:200) The optimal working dilution should be determined by the end user.
• Formulation: In PBS, pH 7.5 (40% glycerol, 0.02% sodium azide)
• Gene: HIVEP3
• Gene Alias: FLJ16752/KBP-1/KBP1/KIAA1555/KRC/SHN3/Schnurri-3/ZAS3/ZNF40C
• Gene Symbols: HIVEP3
• Host Species: Rabbit
• Immunogen: Recombinant protein corresponding to amino acids of human HIVEP3.
• Purification Method: Antigen affinity purification
• Quantity: 100 μL
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 59269
• Target Species: Human
• Content And Storage: Store at 4°C. For long term storage store at -20°C.
  Aliquot to avoid repeated freezing and thawing.
• Form: Liquid
• Isotype: IgG

For Research Use Only