HS2ST1 Rabbit anti-Human, Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-129-609	100 μL

Catalog No. 89-129-609 Supplier Abnova Corporation Supplier No. PAB28104

Description

Rabbit polyclonal antibody raised against recombinant HS2ST1.

Heparan sulfate biosynthetic enzymes are key components in generating a myriad of distinct heparan sulfate fine structures that carry out multiple biologic activities. This gene encodes a member of the heparan sulfate biosynthetic enzyme family that transfers sulfate to the 2 position of the iduronic acid residue of heparan sulfate. The disruption of this gene resulted in no kidney formation in knockout embryonic mice, indicating that the absence of this enzyme may interfere with the signaling required for kidney formation. Two alternatively spliced transcript variants that encode different proteins have been found for this gene. [provided by RefSeq

Sequence: NQIQKLEESRSKLERAIARHEVREIEQRHTMDGPRQDATLDEEEDMVIIYNRVPKTASTSFTNIAYDLCAKNKYHVLH

Specifications

• Antigen: HS2ST1
• Applications: Immunohistochemistry, Western Blot, Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Rabbit polyclonal antibody raised against recombinant HS2ST1.
• Dilution: Immunohistochemistry (1:50-1:200) Western Blot (1:100-1:250) The optimal working dilution should be determined by the end user.
• Formulation: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
• Gene: HS2ST1
• Gene Alias: FLJ11317/KIAA0448/MGC131986/dJ604K5.2
• Gene Symbols: HS2ST1
• Host Species: Rabbit
• Immunogen: Recombinant protein corresponding to amino acids of recombinant HS2ST1.
• Purification Method: Antigen affinity purification
• Quantity: 100 μL
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 9653
• Target Species: Human
• Content And Storage: Store at 4°C. For long term storage store at -20°C.
  Aliquot to avoid repeated freezing and thawing.
• Form: Liquid
• Isotype: IgG

For Research Use Only