IFNGR2, Rabbit, Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-129-889	100 μL

Catalog No. 89-129-889 Supplier Abnova Corporation Supplier No. PAB28384

Description

Rabbit polyclonal antibody raised against recombinant IFNGR2.

This gene (IFNGR2) encodes the nonligand-binding beta chain of the gamma interferon receptor. Human interferon-gamma receptor is a heterodimer of IFNGR1 and IFNGR2. Defects in IFNGR2 are a cause of mendelian susceptibility to mycobacterial disease (MSMD), also known as familial disseminated atypical mycobacterial infection. MSMD is a genetically heterogeneous disease with autosomal recessive, autosomal dominant or X-linked inheritance. [provided by RefSeq

Sequence: ASPSAGFPMDFNVTLRLRAELGALHSAWVTMPWFQHYRNVTVGPPENIEVTPGEGSLIIRFSSPFDIADTSTAFFCYYVHYWEKGGIQQVKGPFRSNSISLDNLKPSRVYCLQVQAQLLWNKSNIFRVGHLSNIS

Specifications

• Antigen: IFNGR2
• Applications: Immunohistochemistry (PFA fixed), Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Rabbit polyclonal antibody raised against recombinant IFNGR2.
• Dilution: Western Blot (1:100-1:250) Immunohistochemistry (1:10-1:20) The optimal working dilution should be determined by the end user.
• Formulation: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
• Gene: IFNGR2
• Gene Alias: AF-1/IFGR2/IFNGT1
• Gene Symbols: IFNGR2
• Host Species: Rabbit
• Immunogen: Recombinant protein corresponding to amino acids of human IFNGR2.
• Purification Method: Antigen affinity purification
• Quantity: 100 μL
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 3460
• Target Species: Human
• Content And Storage: Store at 4°C. For long term storage store at -20°C.
  Aliquot to avoid repeated freezing and thawing.
• Form: Liquid
• Isotype: IgG

For Research Use Only