IGSF11, Rabbit, Polyclonal Antibody, Abnova™

Rabbit polyclonal antibody raised against recombinant IGSF11.

Supplier:  Abnova Corporation PAB24502

Catalog No. 89-126-220

Description

IGSF11 is an immunoglobulin (Ig) superfamily member that is preferentially expressed in brain and testis. It shares significant homology with coxsackievirus and adenovirus receptor (CXADR; MIM 602621) and endothelial cell-selective adhesion molecule (ESAM).[supplied by OMIM

Sequence: PPKCSSAKAFHTEISSSDNNTLTSSNAYNSRYWSNNPKVHRNTESVSHFSDLGQSFSFHSGNANIPSIYANGTHLVPGQHKTLVVTANRGSSPQVMSRSNGSVSRKP

Specifications

• Antigen: IGSF11
• Classification: Polyclonal
• Description: Rabbit polyclonal antibody raised against recombinant IGSF11.
• Formulation: In PBS, pH 7.5 (40% glycerol, 0.02% sodium azide)
• Gene Alias: BT-IgSF/CXADRL1/Igsf13/MGC35227/VSIG3
• Host Species: Rabbit
• Purification Method: Antigen affinity purification
• Regulatory Status: RUO
• Gene ID (Entrez): 152404
• Content And Storage: Store at 4°C. For long term storage store at -20°C.
  Aliquot to avoid repeated freezing and thawing.
• Isotype: IgG

• Applications: Immunohistochemistry (PFA fixed), Western Blot
• Conjugate: Unconjugated
• Dilution: Immunohistochemistry (1:20-1:50) Western Blot (1:250-1:500) The optimal working dilution should be determined by the end user.
• Gene: IGSF11
• Gene Symbols: IGSF11
• Immunogen: Recombinant protein corresponding to amino acids of human IGSF11.
• Quantity: 100 μL
• Primary or Secondary: Primary
• Target Species: Human
• Form: Liquid

For Research Use Only