IL17RE Rabbit anti-Human, Polyclonal Antibody, Abnova™

Rabbit polyclonal antibody raised against recombinant IL17RE.

Supplier:  Abnova Corporation PAB21053

Catalog No. 89-122-549

Description

This gene encodes a protein that shares limited similarity with the interleukin-17 receptor. The function of the encoded protein has not yet been determined. Three alternatively spliced transcript variants of this gene encoding two distinct isoforms have been reported. [provided by RefSeq

Sequence: EKSHHISIPSPDISHKGLRSKRTQPSDPETWESLPRLDSQRHGGPEFSFDLLPEARAIRVTISSGPEVSVRLCHQWALECEELSSPYDVQKIVSGGHTVELPYEFLLPCLCMEASYLQEDTVRRKKCPFQSWPEAYGSDFWKSVHFTDYS

Specifications

• Antigen: IL17RE
• Classification: Polyclonal
• Description: Rabbit polyclonal antibody raised against recombinant IL17RE.
• Formulation: In PBS, pH 7.5 (40% glycerol, 0.02% sodium azide)
• Gene Alias: FLJ23658/MGC71884
• Host Species: Rabbit
• Purification Method: Antigen affinity purification
• Regulatory Status: RUO
• Gene ID (Entrez): 132014
• Content And Storage: Store at 4°C. For long term storage store at -20°C.
  Aliquot to avoid repeated freezing and thawing.
• Isotype: IgG

• Applications: Immunohistochemistry (PFA fixed)
• Conjugate: Unconjugated
• Dilution: Immunohistochemistry (1:50-1:200) The optimal working dilution should be determined by the end user.
• Gene: IL17RE
• Gene Symbols: IL17RE
• Immunogen: Recombinant protein corresponding to amino acids of human IL17RE.
• Quantity: 100 μL
• Primary or Secondary: Primary
• Target Species: Human
• Form: Liquid

For Research Use Only