Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 89126147

IL4I1, Rabbit, Polyclonal Antibody, Abnova™

Catalog No. 89126147 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-126-147 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-126-147 Supplier Abnova Corporation Supplier No. PAB24432

Item Discontinued This item has been discontinued by the supplier. Please to view product availability in your area.

Description

Rabbit polyclonal antibody raised against recombinant IL4I1.

The protein encoded by this gene shares the limited similarity with L-amino acid oxidase, and contains the conserved key amino acid residues thought to be involved in catalysis and binding of the flavin adenine dinucleotide cofactor. The expression of this gene can be induced by interleukin 4 in B cells. Two alternatively spliced transcript variants of this gene encoding two distinct isoforms have been reported. [provided by RefSeq

Sequence: LWQTEKDDWTVPYGRIYFAGEHTAYPHGWVETAVKSALRAAIKINSRKGPASDTASPEGHASDMEGQGHVHGVASSPSHDLAKEEGSHPPVQGQLSLQNTTHT

Specifications

Antigen IL4I1
Applications Immunohistochemistry
Classification Polyclonal
Conjugate Unconjugated
Description interleukin 4 induced 1
Formulation In PBS, pH 7.5 (40% glycerol, 0.02% sodium azide)
Gene IL4I1
Gene Alias FIG1
Gene Symbols IL4I1
Host Species Rabbit
Immunogen Recombinant protein corresponding to amino acids of human IL4I1.
Purification Method Affinity Purified
Quantity 100 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 259307
Target Species Human
Content And Storage Store at 4°C. For long term storage store at -20°C. Aliquot to avoid repeated freezing and thawing.
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.