Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 89122263

KCNC4, Rabbit, Polyclonal Antibody, Abnova™

Catalog No. 89122263 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-122-263 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-122-263 Supplier Abnova Corporation Supplier No. PAB20762
Add to Cart
Add to Cart

Description

Rabbit polyclonal antibody raised against recombinant KCNC4.

The Shaker gene family of Drosophila encodes components of voltage-gated potassium channels and is comprised of four subfamilies. Based on sequence similarity, this gene is similar to the Shaw subfamily. The protein encoded by this gene belongs to the delayed rectifier class of channel proteins and is an integral membrane protein that mediates the voltage-dependent potassium ion permeability of excitable membranes. It generates atypical voltage-dependent transient current that may be important for neuronal excitability. Several transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq

Sequence: ISSVCVSSYRGRKSGNKPPSKTCLKEEMAKGEASEKIIINVGGTRHETYRSTLRTLPGTRLAWLADPD

Specifications

Antigen KCNC4
Applications Immunohistochemistry (PFA fixed)
Classification Polyclonal
Conjugate Unconjugated
Description Rabbit polyclonal antibody raised against recombinant KCNC4.
Dilution Immunohistochemistry (1:50-1:200) The optimal working dilution should be determined by the end user.
Formulation In PBS, pH 7.5 (40% glycerol, 0.02% sodium azide)
Gene KCNC4
Gene Alias HKSHIIIC/KSHIIIC/KV3.4/MGC126818
Gene Symbols KCNC4
Host Species Rabbit
Immunogen Recombinant protein corresponding to amino acids of human KCNC4.
Purification Method Antigen affinity purification
Quantity 100 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 3749
Target Species Human
Content And Storage Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Form Liquid
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.