Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 89125102

KCNG4, Rabbit, Polyclonal Antibody, Abnova™

Catalog No. 89125102 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-125-102 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-125-102 Supplier Abnova Corporation Supplier No. PAB23403

Description

Rabbit polyclonal antibody raised against recombinant KCNG4.

Voltage-gated potassium (Kv) channels represent the most complex class of voltage-gated ion channels from both functional and structural standpoints. Their diverse functions include regulating neurotransmitter release, heart rate, insulin secretion, neuronal excitability, epithelial electrolyte transport, smooth muscle contraction, and cell volume. This gene encodes a member of the potassium channel, voltage-gated, subfamily G. This member functions as a modulatory subunit. The gene has strong expression in brain. Multiple alternatively spliced variants have been found in normal and cancerous tissues. [provided by RefSeq

Sequence: MPMPSRDGGLHPRHHHYGSHSPWSQLLSSPMETPSIKGLYYRRVRKVGALDASPVDLKKEILINVGGRRYLLPWSTLDRF

Specifications

Antigen KCNG4
Applications Immunohistochemistry, Western Blot
Classification Polyclonal
Conjugate Unconjugated
Description potassium voltage-gated channel, subfamily G, member 4
Formulation In PBS, pH 7.5 (40% glycerol, 0.02% sodium azide)
Gene KCNG4
Gene Alias KV6.3, KV6.4, MGC129609, MGC4558
Gene Symbols KCNG4
Host Species Rabbit
Immunogen Recombinant protein corresponding to amino acids of human KCNG4.
Purification Method Affinity Purified
Quantity 100 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 93107
Target Species Human
Content And Storage Store at 4°C. For long term storage store at -20°C. Aliquot to avoid repeated freezing and thawing.
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.