Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

KCNK3, Rabbit, Polyclonal Antibody, Abnova™

Catalog No. 89123522 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-123-522 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-123-522 Supplier Abnova Corporation Supplier No. PAB21820

Rabbit polyclonal antibody raised against recombinant KCNK3.

This gene encodes a member of the superfamily of potassium channel proteins that contain two pore-forming P domains. The encoded protein is an outwardly rectifying channel that is sensitive to changes in extracellular pH and is inhibited by extracellular acidification. Also referred to as an acid-sensitive potassium channel, it is activated by the anesthetics halothane and isoflurane. Although three transcripts are detected in northern blots, there is currently no sequence available to confirm transcript variants for this gene. [provided by RefSeq

Sequence: AVFDALESEPELIERQRLELRQQELRARYNLSQGGYEELERVVLRLKPHKAGVQ

Specifications

Antigen KCNK3
Applications Immunohistochemistry
Classification Polyclonal
Conjugate Unconjugated
Description potassium channel, subfamily K, member 3
Formulation In PBS, pH 7.5 (40% glycerol, 0.02% sodium azide)
Gene KCNK3
Gene Alias K2p3.1, OAT1, TASK, TASK-1, TBAK1
Gene Symbols KCNK3
Host Species Rabbit
Immunogen Recombinant protein corresponding to amino acids of human KCNK3.
Purification Method Affinity Purified
Quantity 100 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 3777
Target Species Human
Content And Storage Store at 4°C. For long term storage store at -20°C. Aliquot to avoid repeated freezing and thawing.
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.