Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

KIAA0319, Rabbit, Polyclonal Antibody, Abnova™

Rabbit polyclonal antibody raised against recombinant KIAA0319.

Manufacturer:  Abnova Corporation PAB20824

Catalog No. 89-122-322


Add to cart

Description

Description

Sequence: GRTYSNAVISPNLETTRIMRVSHTFPVVDCTAACCDLSSCDLAWWFEGRCYLVSCPHKENCEPKKMGPIRSYLTFVLRPVQRPAQLLDYGDMMLNRGSPSGIWGDSPEDIRKDLPFLGKDWGLEEMSEYSDDYRELEKDLLQPSG
Specifications

Specifications

KIAA0319
Unconjugated
Immunohistochemistry (1:200-1:500) The optimal working dilution should be determined by the end user.
KIAA0319
DLX2|DYLX2|DYX2|MGC176717
Rabbit
IgG
100 uL
Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Polyclonal
Human
Immunohistochemistry (PFA fixed)
Rabbit polyclonal antibody raised against recombinant KIAA0319.
In PBS, pH 7.5 (40% glycerol, 0.02% sodium azide)
Liquid
KIAA0319
Recombinant protein corresponding to amino acids of human KIAA0319.
Antigen affinity purification
RUO
Primary
9856
SDS
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

For Research Use Only