Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 89117760

Klhl9, Rabbit, Polyclonal Antibody, Abnova™

Catalog No. 89117760 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-117-760 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-117-760 Supplier Abnova Corporation Supplier No. PAB15695
Add to Cart
Add to Cart

Description

Rabbit polyclonal antibody raised against partial recombinant Klhl9.

Sequence: SEPHYGHAGTVYGGLMYISGGITHDTFQNELMCFDPDTDKWTQKAPMTTVRGLHCMCTVGDKLYVIGGNHFRGTSDYDDVLSCEYYSPTLDQWTPIAAMLRGQSDVGVAVFENKIYVVGGYSWNNRCMVEIVQKYDPEKDEWHKVFDLPESLGGIRACTLTVFPPEENPGSPSRESPLSAPSDHS

Specifications

Antigen Klhl9
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Description Rabbit polyclonal antibody raised against partial recombinant Klhl9.
Dilution Western Blot (1:1000) The optimal working dilution should be determined by the end user.
Formulation In PBS (50% glycerol, 0.02% sodium azide)
Gene Klhl9
Gene Alias 8030469P05/C530050O22Rik/ENSMUSG00000070923/KIAA1354/mKIAA1354
Gene Symbols Klhl9
Host Species Rabbit
Immunogen Recombinant GST fusion protein corresponding to 185 mouse Klhl9.
Quantity 100 μg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 242521
Test Specificity Specific to recombinant protein GX1017. This antibody detects endogenous mKLHL9 protein in several cell types.
Target Species Mouse
Content And Storage Store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Form Liquid
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.