KNG1 Rabbit anti-Human, Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-129-978	100 μL

Catalog No. 89-129-978 Supplier Abnova Corporation Supplier No. PAB28471

Description

Rabbit polyclonal antibody raised against recombinant KNG1

High molecular weight kininogen (HMWK) plays an important role in assembly of the plasma kallikrein (see MIM 147910)-kinin system. The KNG1 gene generates both HMWK and low molecular weight kininogen (LMWK) through alternative splicing. Both HMWK and LMWK contain an identical heavy chain consisting of protein domains 1, 2, and 3. However, HMWK contains a 56kDa light chain that consists of domains 5 and 6H, whereas LMWK contains a unique 4kDa light chain that consists of domain 5L. In both proteins, the heavy and light chains are linked by domain 4, which contains the bradykinin (BK) nonapeptide. BK, which is released by plasma kallikrein, is a potent inflammatory mediator that causes vasodilation and enhanced capillary permeability, induces pain, and stimulates production of nitric oxide and prostacyclin (see MIM 601699) from endothelial cells. During vascular damage, BK stimulates smooth muscle proliferation and intimal hypertrophy. Release of BK from HMWK generates a 2-chain HMWK, termed HMWKa, containing the heavy and light chains joined by a disulfide bond (Merkulov et al., 2008 [PubMed 18000168]).[supplied by OMIM

Sequence: LFLTPDCKSLWNGDTGECTDNAYIDIQLRIASFSQNCDIYPGKDFVQPPTKICVGCPRDIPTNSPELEETLTHTITKLNAENNATFYFKIDNVKKARVQVVAGKKYFIDFVARETTCSKESNEELTESCETK

Specifications

• Antigen: KNG1
• Applications: Immunohistochemistry (PFA fixed), Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Rabbit polyclonal antibody raised against recombinant KNG1
• Dilution: Immunohistochemistry(1:50-1:200) Western Blot(1:100-1:250) The optimal working dilution should be determined by the end user.
• Formulation: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
• Gene: KNG1
• Gene Alias: BDK/KNG
• Gene Symbols: KNG1
• Host Species: Rabbit
• Immunogen: Recombinant protein corresponding to amino acids of human KNG1
• Purification Method: Antigen affinity purification
• Quantity: 100 μL
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 3827
• Target Species: Human
• Content And Storage: Store at 4°C. For long term storage store at -20°C.
  Aliquot to avoid repeated freezing and thawing.
• Form: Liquid
• Isotype: IgG

For Research Use Only