Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 89125399

KRT80, Rabbit, Polyclonal Antibody, Abnova™

Catalog No. 89125399 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-125-399 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-125-399 Supplier Abnova Corporation Supplier No. PAB23690

Description

Rabbit polyclonal antibody raised against recombinant KRT80.

Keratins are intermediate filament proteins responsible for the structural integrity of epithelial cells and are subdivided into epithelial keratins and hair keratins. This gene encodes an epithelial keratin that is weakly expressed in the tongue. The type II keratins are clustered in a region of chromosome 12q13

Sequence: ARSLEEAEAYSRSQLEEQAARSAEYGSSLQSSRSEIADLNVRIQKLRSQILSVKSHCLKLEENIKTAEEQGELAFQDAKTKLAQ

Specifications

Antigen KRT80
Applications Immunohistochemistry, Western Blot
Classification Polyclonal
Conjugate Unconjugated
Description keratin 80
Formulation In PBS, pH 7.5 (40% glycerol, 0.02% sodium azide)
Gene KRT80
Gene Alias KB20
Gene Symbols KRT80
Host Species Rabbit
Immunogen Recombinant protein corresponding to amino acids of human KRT80.
Purification Method Affinity Purified
Quantity 100 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 144501
Target Species Human
Content And Storage Store at 4°C. For long term storage store at -20°C. Aliquot to avoid repeated freezing and thawing.
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.