LRBA Rabbit anti-Human, Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-123-090	100 μL

Catalog No. 89-123-090 Supplier Abnova Corporation Supplier No. PAB21593

Description

Rabbit polyclonal antibody raised against recombinant LRBA.

Patients with Chediak-Higashi syndrome (CHS1; MIM 214500) suffer from a systemic immunodeficiency involving defects in polarized trafficking of vesicles in a number of immune system cell types. In mouse, this syndrome is reproduced in strains with a mutation in the 'beige' gene that results in proteins lacking the BEACH (beige and CHS1) domain and C-terminal WD repeats. LRBA contains key features of both beige/CHS1 and A kinase anchor proteins (AKAPs; see MIM 602449).[supplied by OMIM

Sequence: GGWRVWVDTLSITHSKVTFEIHKENLANIFREQQGKVDEEIGLCSSTSVQAASGIRRDINVSVGSQQPDTKDSPVCPHFTTNGNENSSIEKTSSLESASNIELQTTNTSYEEMKAEQENQELPDEGTLEETL

Specifications

• Antigen: LRBA
• Applications: Immunohistochemistry (PFA fixed)
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Rabbit polyclonal antibody raised against recombinant LRBA.
• Dilution: Immunohistochemistry (1:200-1:500) The optimal working dilution should be determined by the end user.
• Formulation: In PBS, pH 7.5 (40% glycerol, 0.02% sodium azide)
• Gene: LRBA
• Gene Alias: BGL/CDC4L/DKFZp686A09128/DKFZp686K03100/DKFZp686P2258/FLJ16600/FLJ25686/LAB300/LBA/MGC72098
• Gene Symbols: LRBA
• Host Species: Rabbit
• Immunogen: Recombinant protein corresponding to amino acids of human LRBA.
• Purification Method: Antigen affinity purification
• Quantity: 100 μL
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 987
• Target Species: Human
• Content And Storage: Store at 4°C. For long term storage store at -20°C.
  Aliquot to avoid repeated freezing and thawing.
• Form: Liquid
• Isotype: IgG

For Research Use Only