LRPPRC, Rabbit, Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-124-697	100 μL

Catalog No. 89-124-697 Supplier Abnova Corporation Supplier No. PAB22998

Description

Rabbit polyclonal antibody raised against recombinant LRPPRC.

This gene encodes a protein that is leucine-rich and is thought to play a role in regulating the interaction of the cytoskeleton with a variety of cellular processes. Mutations in this gene are associated with the French-Canadian type of Leigh syndrome. Transcripts ranging in size from 4.8 to 7.0kb which result from alternative polyadenylation have been reported for this gene. [provided by RefSeq

Sequence: RIWDTLQKLGAVYDVSHYNALLKVYLQNEYKFSPTDFLAKMEEANIQPNRVTYQRLIASYCNVGDIEGASKILGFMKTKDLPVT

Specifications

• Antigen: LRPPRC
• Applications: Immunofluorescence, Immunohistochemistry (PFA fixed), Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Rabbit polyclonal antibody raised against recombinant LRPPRC.
• Dilution: Immunohistochemistry (1:10-1:20) Western Blot (1:250-1:500) Immunofluorescence (1-4 ug/mL) The optimal working dilution should be determined by the end user.
• Formulation: In PBS, pH 7.5 (40% glycerol, 0.02% sodium azide)
• Gene: LRPPRC
• Gene Alias: CLONE-23970/GP130/LRP130/LSFC
• Gene Symbols: LRPPRC
• Host Species: Rabbit
• Immunogen: Recombinant protein corresponding to amino acids of human LRPPRC.
• Purification Method: Antigen affinity purification
• Quantity: 100 μL
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 10128
• Target Species: Human
• Content And Storage: Store at 4°C. For long term storage store at -20°C.
  Aliquot to avoid repeated freezing and thawing.
• Form: Liquid
• Isotype: IgG

For Research Use Only