Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 89122955

LRRC46, Rabbit, Polyclonal Antibody, Abnova™

Catalog No. 89122955 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-122-955 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-122-955 Supplier Abnova Corporation Supplier No. PAB21460

Description

Rabbit polyclonal antibody raised against recombinant LRRC46.

Sequence: PTLTDLPLLPGVPMAGDSSPSATPAQGEETVPEAVSSPQASSPTKKPCSLIPRGHQSSFWGRKGARAATAPKASVAEAPSTTKTT

Specifications

Antigen LRRC46
Applications Immunohistochemistry, Western Blot
Classification Polyclonal
Conjugate Unconjugated
Description leucine rich repeat containing 46
Formulation In PBS, pH 7.5 (40% glycerol, 0.02% sodium azide)
Gene LRRC46
Gene Alias FLJ23553, MGC16309
Gene Symbols LRRC46
Host Species Rabbit
Immunogen Recombinant protein corresponding to amino acids of human LRRC46.
Purification Method Affinity Purified
Quantity 100 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 90506
Target Species Human
Content And Storage Store at 4°C. For long term storage store at -20°C. Aliquot to avoid repeated freezing and thawing.
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.