Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 89122406

LRRC8A, Rabbit, Polyclonal Antibody, Abnova™

Catalog No. 89122406 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-122-406 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-122-406 Supplier Abnova Corporation Supplier No. PAB20905

Item Discontinued This item has been discontinued by the supplier. Please to view product availability in your area.

Description

Rabbit polyclonal antibody raised against recombinant LRRC8A.

This gene encodes a protein belonging to the leucine-rich repeat family of proteins, which are involved in diverse biological processes, including cell adhesion, cellular trafficking, and hormone-receptor interactions. This family member is a putative four-pass transmembrane protein that plays a role in B cell development. Defects in this gene cause autosomal dominant non-Bruton type agammaglobulinemia, an immunodeficiency disease resulting from defects in B cell maturation. Multiple alternatively spliced transcript variants, which encode the same protein, have been identified for this gene. [provided by RefSeq

Sequence: ICLPCKWVTKDSCNDSFRGWAAPGPEPTYPNSTILPTPDTGPTGIKYDLDRHQYNYVDAVCYENRLHWFAK

Specifications

Antigen LRRC8A
Applications Immunohistochemistry
Classification Polyclonal
Conjugate Unconjugated
Description leucine rich repeat containing 8 family, member A
Formulation In PBS, pH 7.5 (40% glycerol, 0.02% sodium azide)
Gene LRRC8A
Gene Alias FLJ10337, FLJ41617, KIAA1437, LRRC8
Gene Symbols LRRC8A
Host Species Rabbit
Immunogen Recombinant protein corresponding to amino acids of human LRRC8A.
Purification Method Affinity Purified
Quantity 100 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 56262
Target Species Human
Content And Storage Store at 4°C. For long term storage store at -20°C. Aliquot to avoid repeated freezing and thawing.
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.