LSM5, Rabbit, Polyclonal Antibody, Abnova™

Rabbit polyclonal antibody raised against recombinant LSM5

Supplier:  Abnova Corporation PAB28019

Catalog No. 89-129-535

Description

Sm-like proteins were identified in a variety of organisms based on sequence homology with the Sm protein family (see SNRPD2; MIM 601061). Sm-like proteins contain the Sm sequence motif, which consists of 2 regions separated by a linker of variable length that folds as a loop. The Sm-like proteins are thought to form a stable heteromer present in tri-snRNP particles, which are important for pre-mRNA splicing.[supplied by OMIM

Sequence: LLPLELVDKCIGSRIHIVMKSDKEIVGTLLGFDDFVNMVLEDVTEFEITPEGRRITKLDQILLNGNNITMLV

Specifications

• Antigen: LSM5
• Classification: Polyclonal
• Description: Rabbit polyclonal antibody raised against recombinant LSM5
• Formulation: In PBS, pH 7.2, (40% glycerol, 0.02% sodium azide)
• Gene Alias: FLJ12710/YER146W
• Host Species: Rabbit
• Purification Method: Antigen affinity purification
• Regulatory Status: RUO
• Gene ID (Entrez): 23658
• Content And Storage: Store at 4°C. For long term storage store at -20°C.
  Aliquot to avoid repeated freezing and thawing.
• Isotype: IgG

• Applications: Immunohistochemistry (PFA fixed), Western Blot
• Conjugate: Unconjugated
• Dilution: Immunohistochemistry (1:20 - 1:50) Western Blot (1:100 - 1:250) The optimal working dilution should be determined by the end user.
• Gene: LSM5
• Gene Symbols: LSM5
• Immunogen: Recombinant protein corresponding to amino acids of human LSM5
• Quantity: 100 μL
• Primary or Secondary: Primary
• Target Species: Human
• Form: Liquid

For Research Use Only