Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

LSM5, Rabbit, Polyclonal Antibody, Abnova™

Rabbit polyclonal antibody raised against recombinant LSM5

Supplier:  Abnova Corporation PAB28019

Catalog No. 89-129-535


Add to Cart

Description

Description

Sm-like proteins were identified in a variety of organisms based on sequence homology with the Sm protein family (see SNRPD2; MIM 601061). Sm-like proteins contain the Sm sequence motif, which consists of 2 regions separated by a linker of variable length that folds as a loop. The Sm-like proteins are thought to form a stable heteromer present in tri-snRNP particles, which are important for pre-mRNA splicing.[supplied by OMIM

Sequence: LLPLELVDKCIGSRIHIVMKSDKEIVGTLLGFDDFVNMVLEDVTEFEITPEGRRITKLDQILLNGNNITMLV
Specifications

Specifications

LSM5
Polyclonal
Rabbit polyclonal antibody raised against recombinant LSM5
In PBS, pH 7.2, (40% glycerol, 0.02% sodium azide)
FLJ12710/YER146W
Rabbit
Antigen affinity purification
RUO
23658
Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
IgG
Immunohistochemistry (PFA fixed), Western Blot
Unconjugated
Immunohistochemistry (1:20 - 1:50) Western Blot (1:100 - 1:250) The optimal working dilution should be determined by the end user.
LSM5
LSM5
Recombinant protein corresponding to amino acids of human LSM5
100 μL
Primary
Human
Liquid
Product Suggestions

Product Suggestions

SDS
Documents

Documents

Product Certifications
Promotions

Promotions

Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

For Research Use Only