Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

MEGF10, Rabbit, Polyclonal Antibody, Abnova™

Catalog No. 89123551 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-123-551 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-123-551 Supplier Abnova Corporation Supplier No. PAB21849

Rabbit polyclonal antibody raised against recombinant MEGF10.

Sequence: NGGTCDAATGQCHCSPGYTGERCQDECPVGTYGVLCAETCQCVNGGKCYHVSGACLCEAGFAGERCEARLCPEGLYGIKCDKRCPCHLENTHSCHPMSGECACKPGWSGLYCNETCSPGFYGEACQQICSCQNGADCDSVTGKCTCA

Specifications

Antigen MEGF10
Applications Immunohistochemistry
Classification Polyclonal
Conjugate Unconjugated
Description multiple EGF-like-domains 10
Formulation In PBS, pH 7.5 (40% glycerol, 0.02% sodium azide)
Gene MEGF10
Gene Alias DKFZp781K1852, FLJ41574, KIAA1780
Gene Symbols MEGF10
Host Species Rabbit
Immunogen Recombinant protein corresponding to amino acids of human MEGF10.
Purification Method Affinity Purified
Quantity 100 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 84466
Target Species Human
Content And Storage Store at 4°C. For long term storage store at -20°C. Aliquot to avoid repeated freezing and thawing.
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.