MEIS2, Rabbit, Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-130-266	100 μL

Catalog No. 89-130-266 Supplier Abnova Corporation Supplier No. PAB28747

Description

Rabbit polyclonal antibody raised against recombinant MEIS2.

This gene encodes a homeobox protein belonging to the TALE ('three amino acid loop extension') family of homeodomain-containing proteins. TALE homeobox proteins are highly conserved transcription regulators, and several members have been shown to be essential contributors to developmental programs. Multiple transcript variants encoding distinct isoforms have been described for this gene. [provided by RefSeq]

Sequence: LEKVHELCDNFCHRYISCLKGKMPIDLVIDERDGSSKSDHEELSGSSTNLADHNPSSWRDHDDATSTHSAGTPGPSSGGHASQSGDNSSEQGDGLDNSV

Specifications

• Antigen: MEIS2
• Applications: Immunofluorescence, Immunohistochemistry, Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Rabbit polyclonal antibody raised against recombinant MEIS2.
• Dilution: Immunohistochemistry (1:200-1:500) Immunofluorescence (1-4 ug/ml) Western Blot (1:100-1:250) The optimal working dilution should be determined by the end user.
• Formulation: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
• Gene: MEIS2
• Gene Alias: HsT18361/MGC2820/MRG1
• Gene Symbols: MEIS2
• Host Species: Rabbit
• Immunogen: Recombinant protein corresponding to amino acids of human MEIS2.
• Purification Method: Antigen affinity purification
• Quantity: 100 μL
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 4212
• Target Species: Human
• Content And Storage: Store at 4°C. For long term storage store at -20°C.
  Aliquot to avoid repeated freezing and thawing.
• Form: Liquid
• Isotype: IgG

For Research Use Only