MFSD8, Rabbit, Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-126-073	100 μL

Catalog No. 89-126-073 Supplier Abnova Corporation Supplier No. PAB24363

Description

Rabbit polyclonal antibody raised against recombinant MFSD8.

This gene encodes a ubiquitous integral membrane protein that contains a transporter domain and a major facilitator superfamily (MFS) domain. Other members of the major facilitator superfamily transport small solutes through chemiosmotic ion gradients. The substrate transported by this protein is unknown. The protein likely localizes to lysosomal membranes. Mutations in this gene are correlated with a variant form of late infantile-onset neuronal ceroid lipofuscinoses (vLINCL). [provided by RefSeq

Sequence: MAGLRNESEQEPLLGDTPGSREWDILETEEHYKSRWR

Specifications

• Antigen: MFSD8
• Applications: Immunofluorescence, Immunohistochemistry (PFA fixed), Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Rabbit polyclonal antibody raised against recombinant MFSD8.
• Dilution: Immunohistochemistry (1:50-1:200) Immunofluorescence (1-4 ug/mL) The optimal working dilution should be determined by the end user.
• Formulation: In PBS, pH 7.5 (40% glycerol, 0.02% sodium azide)
• Gene: MFSD8
• Gene Alias: CLN7/MGC33302
• Gene Symbols: MFSD8
• Host Species: Rabbit
• Immunogen: Recombinant protein corresponding to amino acids of human MFSD8.
• Purification Method: Antigen affinity purification
• Quantity: 100 μL
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 256471
• Target Species: Human
• Content And Storage: Store at 4°C. For long term storage store at -20°C.
  Aliquot to avoid repeated freezing and thawing.
• Form: Liquid
• Isotype: IgG

For Research Use Only