Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

MGAM, Rabbit, Polyclonal Antibody, Abnova™

Rabbit polyclonal antibody raised against recombinant MGAM.

Supplier:  Abnova Corporation PAB27460

Catalog No. 89-128-971


Add to Cart

Description

Description

This gene encodes maltase-glucoamylase, which is a brush border membrane enzyme that plays a role in the final steps of digestion of starch. The protein has two catalytic sites identical to those of sucrase-isomaltase, but the proteins are only 59% homologous. Both are members of glycosyl hydrolase family 31, which has a variety of substrate specificities. [provided by RefSeq

Sequence: VYLLCEFSVTQNRLEVNISQSTYKDPNNLAFNEIKILGTEEPSNVTVKHNGVPSQTSPTVTYDSNLKVAIITDIDLLLGEAYTVEWSIKIRDEEKIDCYPDENGASAENCTARGCIWEASNSSGVP
Specifications

Specifications

MGAM
Polyclonal
Rabbit polyclonal antibody raised against recombinant MGAM.
In PBS, pH 7.2, (40% glycerol, 0.02% sodium azide)
MG/MGA
Rabbit
Antigen affinity purification
RUO
8972
Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
IgG
Immunohistochemistry (PFA fixed)
Unconjugated
Immunohistochemistry (1:1000-1:2500) The optimal working dilution should be determined by the end user.
MGAM
MGAM
Recombinant protein corresponding to amino acids of human MGAM.
100 μL
Primary
Human
Liquid
Product Suggestions

Product Suggestions

SDS
Documents

Documents

Product Certifications
Promotions

Promotions

Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

For Research Use Only