Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Morc2a, Rabbit, Polyclonal Antibody, Abnova™

Catalog No. 89117794 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
50 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-117-794 50 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-117-794 Supplier Abnova Corporation Supplier No. PAB15729
Add to Cart
Add to Cart

Rabbit polyclonal antibody raised against partial recombinant Morc2a.

Sequence: KDKGLHVEVRVNREWYTGRVTAVEVGKNAVRWKVKFDYVPTDTTPRDRWVEKGSEDVRLMKPPSPEHQSPDTQQEGGEEEEAMVARQAVALPEPSTSDGLPIEPDTTATSPSHETIDLLVQILRNCLRYFLPPSFPISKKELSVMNSEELISFPLKEYFKQYEVGLQNLCHSYQSRADSRAKASEESLRTSEKKLRETEEKLQKLRTNIVALLQKVQEDIDINTDDELDAYIEDLITKGD

Specifications

Antigen Morc2a
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Description Rabbit polyclonal antibody raised against partial recombinant Morc2a.
Dilution Western Blot (1:1000) The optimal working dilution should be determined by the end user.
Formulation In PBS (50% glycerol, 0.02% sodium azide)
Gene Morc2a
Gene Alias 8430403M08Rik/Zcwcc1
Gene Symbols Morc2a
Host Species Rabbit
Immunogen Recombinant GST fusion protein corresponding to 240 mouse Morc2a.
Quantity 50 μg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 74522
Test Specificity Specific to recombinant protein GX1256. This antibody detects mMORC2A protein. It also recognizes human MORC2A protein.
Target Species Mouse
Content And Storage Store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Form Liquid
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.