Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

MSS51, Rabbit, Polyclonal Antibody, Abnova™

Rabbit polyclonal antibody raised against recombinant MSS51.

Supplier: Abnova Corporation PAB23306

Catalog No. 89-125-005

Description

Sequence: DWDSWFSMKGLHLDATLDAVLVSHAVTTLWASVGRPRPDPDVLQGSLKRLLTDVLSRPLTLGLGLRALGIDVRRTGGSTVHVVGAS

Specifications

Antigen	MSS51
Classification	Polyclonal
Description	MSS51 mitochondrial translational activator homolog (S. cerevisiae)
Gene	MSS51
Gene Symbols	MSS51
Immunogen	Recombinant protein corresponding to amino acids of human MSS51.
Quantity	100 μL
Primary or Secondary	Primary
Target Species	Human
Isotype	IgG

Applications	Immunohistochemistry, Western Blot
Conjugate	Unconjugated
Formulation	In PBS, pH 7.5 (40% glycerol, 0.02% sodium azide)
Gene Alias	RP11-345K20.3, ZMYND17
Host Species	Rabbit
Purification Method	Affinity Purified
Regulatory Status	RUO
Gene ID (Entrez)	118490
Content And Storage	Store at 4°C. For long term storage store at -20°C. Aliquot to avoid repeated freezing and thawing.

Product Suggestions

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Your feedback has been submitted: Thank you for helping us improve our website.

For Research Use Only

Spot an opportunity for improvement?Share a Content Correction

MSS51, Rabbit, Polyclonal Antibody, Abnova™

Description

Specifications

Product Suggestions

Documents

Promotions