MVP Rabbit anti-Human, Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-130-060	100 μL

Catalog No. 89-130-060 Supplier Abnova Corporation Supplier No. PAB28550

Description

Rabbit polyclonal antibody raised against recombinant MVP.

This gene encodes the major vault protein which is a lung resistance-related protein. Vaults are multi-subunit structures that may be involved in nucleo-cytoplasmic transport. This protein mediates drug resistance, perhaps via a transport process. It is widely distributed in normal tissues, and overexpressed in multidrug-resistant cancer cells. The protein overexpression is a potentially useful marker of clinical drug resistance. This gene produces two transcripts by using two alternative exon 2 sequences; however, the open reading frames are the same in both transcripts. [provided by RefSeq

Sequence: VFEEVLDLVDAVILTEKTALHLRARRNFRDFRGVSRRTGEEWLVTVQDTEAHVPDVHEEVLGVVPITTLGPHNYCVILDPVGPDGKNQLGQKRVVKGEKSFFLQPGEQLEQGIQDVYVLS

Specifications

• Antigen: MVP
• Applications: Immunofluorescence, Immunohistochemistry (PFA fixed), Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Rabbit polyclonal antibody raised against recombinant MVP.
• Dilution: Immunohistochemistry(1:200-1:500) Western Blot(1:250-1:500) Immunofluorescence (1-4 ug/ml) The optimal working dilution should be determined by the end user.
• Formulation: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
• Gene: MVP
• Gene Alias: LRP/VAULT1
• Gene Symbols: MVP
• Host Species: Rabbit
• Immunogen: Recombinant protein corresponding to amino acids of recombinant MVP.
• Purification Method: Antigen affinity purification
• Quantity: 100 μL
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 9961
• Target Species: Human
• Content And Storage: Store at 4°C. For long term storage store at -20°C.
  Aliquot to avoid repeated freezing and thawing.
• Form: Liquid
• Isotype: IgG

For Research Use Only