NAE1 Rabbit anti-Human, Polyclonal Antibody, Abnova™

Rabbit polyclonal antibody raised against recombinant NAE1.

Supplier:  Abnova Corporation PAB27899

Catalog No. 89-129-422

Description

The protein encoded by this gene binds to the beta-amyloid precursor protein. Beta-amyloid precursor protein is a cell surface protein with signal-transducing properties, and it is thought to play a role in the pathogenesis of Alzheimer's disease. In addition, the encoded protein can form a heterodimer with UBE1C and bind and activate NEDD8, a ubiquitin-like protein. This protein is required for cell cycle progression through the S/M checkpoint. Three transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq

Sequence: PSFWILARALKEFVAKEGQGNLPVRGTIPDMIADSGKYIKLQNVYREKAKKDAAAVGNHVAKLLQSIGQAPESISEKELKLLCSNSAFLRVVRCRSLAEEYGLDTINKDE

Specifications

• Antigen: NAE1
• Classification: Polyclonal
• Description: Rabbit polyclonal antibody raised against recombinant NAE1.
• Formulation: In PBS, pH 7.2, (40% glycerol, 0.02% sodium azide)
• Gene Alias: A-116A10.1/APPBP1/HPP1/ula-1
• Host Species: Rabbit
• Purification Method: Antigen affinity purification
• Regulatory Status: RUO
• Gene ID (Entrez): 8883
• Content And Storage: Store at 4°C. For long term storage store at -20°C.
  Aliquot to avoid repeated freezing and thawing.
• Isotype: IgG

• Applications: Immunohistochemistry (PFA fixed), Western Blot
• Conjugate: Unconjugated
• Dilution: Immunohistochemistry (1:200-1:500) Western Blot (1:100-1:250) The optimal working dilution should be determined by the end user.
• Gene: NAE1
• Gene Symbols: NAE1
• Immunogen: Recombinant protein corresponding to amino acids of human NAE1.
• Quantity: 100 μL
• Primary or Secondary: Primary
• Target Species: Human
• Form: Liquid

For Research Use Only