NCAPH, subunit H, Rabbit, Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-130-190	100 μL

Catalog No. 89-130-190 Supplier Abnova Corporation Supplier No. PAB28677

Description

Rabbit polyclonal antibody raised against recombinant NCAPH, subunit H.

This gene encodes a member of the barr gene family and a regulatory subunit of the condensin complex. This complex is required for the conversion of interphase chromatin into condensed chromosomes. The protein encoded by this gene is associated with mitotic chromosomes, except during the early phase of chromosome condensation. During interphase, the protein has a distinct punctate nucleolar localization. [provided by RefSeq

Sequence: LHCQDYRSELLFPSDVQTLSTGEPLELPELGCVEMTDLKAPLQQCAEDRQICPSLAGFQFTQWDSETHNESVSALVDKFKKNDQVFDINAEVDESDCGDFPDGSLGDDFDANDEPDHT

Specifications

• Antigen: NCAPH, subunit H
• Applications: Immunohistochemistry, Western Blot, Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Rabbit polyclonal antibody raised against recombinant NCAPH, subunit H.
• Dilution: Immunohistochemistry (1:50-1:200) Western Blot (1:100-1:500) The optimal working dilution should be determined by the end user.
• Formulation: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
• Gene: NCAPH
• Gene Alias: BRRN1/CAP-H/HCAP-H
• Gene Symbols: NCAPH
• Host Species: Rabbit
• Immunogen: Recombinant protein corresponding to amino acids of human NCAPH.
• Purification Method: Antigen affinity purification
• Quantity: 100 μL
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 23397
• Target Species: Human, Mouse, Rat
• Content And Storage: Store at 4°C. For long term storage store at -20°C.
  Aliquot to avoid repeated freezing and thawing.
• Form: Liquid
• Isotype: IgG

For Research Use Only