NCF2, Rabbit, Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-130-061	100 μL

Catalog No. 89-130-061 Supplier Abnova Corporation Supplier No. PAB28551

Description

Rabbit polyclonal antibody raised against recombinant NCF2.

This gene encodes neutrophil cytosolic factor 2, the 67-kilodalton cytosolic subunit of the multi-protein NADPH oxidase complex found in neutrophils. This oxidase produces a burst of superoxide which is delivered to the lumen of the neutrophil phagosome. Mutations in this gene, as well as in other NADPH oxidase subunits, can result in chronic granulomatous disease, a disease that causes recurrent infections by catalase-positive organisms. Alternative splicing results in two transcript variants that encode the same protein. [provided by RefSeq

Sequence: QEESSPQSDIPAPPSSKAPGRPQLSPGQKQKEEPKEVKLSVPMPYTLKVHYKYTVVMKTQPGLPYSQVRDMVSKKLELRLEHTKLSYRPRDSNELVPLSEDSMKDAWGQVKNYCLTLWCENTVGDQGFPDEPKESEKADANNQTTEPQ

Specifications

• Antigen: NCF2
• Applications: Immunohistochemistry (PFA fixed), Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Rabbit polyclonal antibody raised against recombinant NCF2.
• Dilution: Immunohistochemistry(1:200-1:500) Western Blot(1:100-1:250) The optimal working dilution should be determined by the end user.
• Formulation: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
• Gene: NCF2
• Gene Alias: FLJ93058/NCF-2/NOXA2/P67-PHOX/P67PHOX
• Gene Symbols: NCF2
• Host Species: Rabbit
• Immunogen: Recombinant protein corresponding to amino acids of recombinant NCF2.
• Purification Method: Antigen affinity purification
• Quantity: 100 μL
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 4688
• Target Species: Human
• Content And Storage: Store at 4°C. For long term storage store at -20°C.
  Aliquot to avoid repeated freezing and thawing.
• Form: Liquid
• Isotype: IgG

For Research Use Only