NDRG2 Rabbit anti-Human, Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-130-248	100 μL

Catalog No. 89-130-248 Supplier Abnova Corporation Supplier No. PAB28730

Description

Rabbit polyclonal antibody raised against recombinant NDRG2.

This gene is a member of the N-myc downregulated gene family which belongs to the alpha/beta hydrolase superfamily. The protein encoded by this gene is a cytoplasmic protein that may play a role in neurite outgrowth. This gene may be involved in glioblastoma carcinogenesis. Several alternatively spliced transcript variants of this gene have been described, but the full-length nature of some of these variants has not been determined. [provided by RefSeq

Sequence: TGLTSSIPEMILGHLFSQEELSGNSELIQKYRNIITHAPNLDNIELYWNSYNNRRDLNFERGGDITLRCPVMLVVGDQAPHEDAVVECNSKLDPTQTSFLKMADSGGQP

Specifications

• Antigen: NDRG2
• Applications: Immunofluorescence, Immunohistochemistry, Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Rabbit polyclonal antibody raised against recombinant NDRG2.
• Dilution: Immunohistochemistry (1:2500-1:5000) Immunofluorescence (1-4 ug/ml) Western Blot (1:100-1:250) The optimal working dilution should be determined by the end user.
• Formulation: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
• Gene: NDRG2
• Gene Alias: DKFZp781G1938/FLJ25522/KIAA1248/SYLD
• Gene Symbols: NDRG2
• Host Species: Rabbit
• Immunogen: Recombinant protein corresponding to amino acids of human NDRG2.
• Purification Method: Antigen affinity purification
• Quantity: 100 μL
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 57447
• Target Species: Human
• Content And Storage: Store at 4°C. For long term storage store at -20°C.
  Aliquot to avoid repeated freezing and thawing.
• Form: Liquid
• Isotype: IgG

For Research Use Only