NDUFB7, beta subcomplex 1, Rabbit, Polyclonal Antibody, Abnova™

Rabbit polyclonal antibody raised against recombinant NDUFB7, beta subcomplex 1.

Supplier:  Abnova Corporation PAB28689

Catalog No. 89-130-203

Description

The protein encoded by this gene is a subunit of the multisubunit NADH:ubiquinone oxidoreductase (complex I). Mammalian complex I is composed of 45 different subunits. It is located at the mitochondrial inner membrane. This protein has NADH dehydrogenase activity and oxidoreductase activity. It transfers electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone. [provided by RefSeq

Sequence: FPERKEREMVATQQEMMDAQLRLQLRDYCAHHLIRLLKCKRDSFPNFLACKQERHDWDYCEHRDYVMRMKEFERERRLLQRKKRREKKAAELAKGQGPGEVDPKV

Specifications

• Antigen: NDUFB7, beta subcomplex 1
• Classification: Polyclonal
• Description: Rabbit polyclonal antibody raised against recombinant NDUFB7, beta subcomplex 1.
• Formulation: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
• Gene Alias: B18/CI-B18/MGC2480
• Host Species: Rabbit
• Purification Method: Antigen affinity purification
• Regulatory Status: RUO
• Gene ID (Entrez): 4713
• Content And Storage: Store at 4°C. For long term storage store at -20°C.
  Aliquot to avoid repeated freezing and thawing.
• Isotype: IgG

• Applications: Immunohistochemistry, Western Blot
• Conjugate: Unconjugated
• Dilution: Immunohistochemistry (1:20-1:50) Western Blot (1:100-1:500) The optimal working dilution should be determined by the end user.
• Gene: NDUFB7
• Gene Symbols: NDUFB7
• Immunogen: Recombinant protein corresponding to amino acids of human NDUFB7.
• Quantity: 100 μL
• Primary or Secondary: Primary
• Target Species: Human, Mouse, Rat
• Form: Liquid

For Research Use Only