NIPA1, Rabbit, Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-122-997	100 μL

Catalog No. 89-122-997 Supplier Abnova Corporation Supplier No. PAB21503

Description

Rabbit polyclonal antibody raised against recombinant NIPA1.

This gene encodes a magnesium transporter that associates with early endosomes and the cell surface in a variety of neuronal and epithelial cells. This protein may play a role in nervous system development and maintenance. Multiple transcript variants encoding different isoforms have been found for this gene. Mutations in this gene have been associated with autosomal dominant spastic paraplegia 6. [provided by RefSeq

Sequence: HGPTNIMVYISICSLLGSFTVPSTKGIGLAAQDILHNNPSSQRA

Specifications

• Antigen: NIPA1
• Applications: Immunohistochemistry (PFA fixed)
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Rabbit polyclonal antibody raised against recombinant NIPA1.
• Dilution: Immunohistochemistry (1:10-1:20) The optimal working dilution should be determined by the end user.
• Formulation: In PBS, pH 7.5 (40% glycerol, 0.02% sodium azide)
• Gene: NIPA1
• Gene Alias: FSP3/MGC102724/MGC35570/SPG6
• Gene Symbols: NIPA1
• Host Species: Rabbit
• Immunogen: Recombinant protein corresponding to amino acids of human NIPA1.
• Purification Method: Antigen affinity purification
• Quantity: 100 μL
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 123606
• Target Species: Human
• Content And Storage: Store at 4°C. For long term storage store at -20°C.
  Aliquot to avoid repeated freezing and thawing.
• Form: Liquid
• Isotype: IgG

For Research Use Only