Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

NLRX1 Rabbit, Polyclonal Antibody, Abnova™

Catalog No. 89125017 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-125-017 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-125-017 Supplier Abnova Corporation Supplier No. PAB23319

Rabbit polyclonal antibody raised against recombinant NLRX1.

This gene encodes a member of the NLR family. Alternative splicing has been observed at this gene locus and two transcript variants, encoding distinct isoforms, have been identified. [provided by RefSeq

Sequence: ELLHLYFNELSSEGRQVLRDLGGAAEGGARVVVSLTEGTAVSEYWSVILSEVQRNLNSWDRARVQRHLELLLRDLEDSRGATLNPWRKAQLLRVEGEVRALLEQLGSSGS

Specifications

Antigen NLRX1
Applications Immunohistochemistry, Western Blot
Classification Polyclonal
Conjugate Unconjugated
Description NLR family member X1
Formulation In PBS, pH 7.5 (40% glycerol, 0.02% sodium azide)
Gene NLRX1
Gene Alias CLR11.3, DLNB26, FLJ21478, MGC131937, MGC21025, NOD26, NOD5, NOD9
Gene Symbols NLRX1
Host Species Rabbit
Immunogen Recombinant protein corresponding to amino acids of human NLRX1.
Purification Method Affinity Purified
Quantity 100 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 79671
Target Species Human, Rat
Content And Storage Store at 4°C. For long term storage store at -20°C. Aliquot to avoid repeated freezing and thawing.
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.