Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

NPPB Rabbit anti-Rat, Polyclonal Antibody, Abnova™

Catalog No. 89131729 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
150 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-131-729 150 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-131-729 Supplier Abnova Corporation Supplier No. PAB5082
Add to Cart
Add to Cart

Rabbit polyclonal antibody raised against synthetic peptide of Nppb.

Sequence: NSKMAHSSSCFGQKIDRIGAVSRLGCDGLRLF

Specifications

Antigen NPPB
Applications ELISA, Immunoprecipitation
Classification Polyclonal
Conjugate Unconjugated
Description Rabbit polyclonal antibody raised against synthetic peptide of Nppb.
Dilution The optimal working dilution should be determined by the end user.
Formulation In PBS, pH 7.5 (50% glycerol, 0.01% thimerosal)
Gene Nppb
Gene Alias BNP/Bnf
Gene Symbols Nppb
Host Species Rabbit
Immunogen A synthetic peptide (conjugated with KLH) corresponding to rat Nppb.
Quantity 150 μg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 25105
Target Species Rat
Content And Storage Store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Form Liquid
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.