Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 89131661

NPPC Rabbit anti-Human, Polyclonal Antibody, Abnova™

Catalog No. 89131661 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
150 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-131-661 150 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-131-661 Supplier Abnova Corporation Supplier No. PAB4978
Add to Cart
Add to Cart

Description

Rabbit polyclonal antibody raised against synthetic peptide of NPPC.

Natriuretic peptides comprise a family of 3 structurally related molecules: atrial natriuretic peptide (ANP; MIM 108780), brain natriuretic peptide (BNP; MIM 600295), and C-type natriuretic peptide, CNP, encoded by a gene symbolized NPPC. These peptides possess potent natriuretic, diuretic, and vasodilating activities and are implicated in body fluid homeostasis and blood pressure control.[supplied by OMIM

Sequence: DLRVDTKSRAAWARLLQEHPNARKYKGANKKGLSKGCFGLKLDRIGSMSGLGC

Specifications

Antigen NPPC
Applications ELISA, Immunoprecipitation
Classification Polyclonal
Conjugate Unconjugated
Description Rabbit polyclonal antibody raised against synthetic peptide of NPPC.
Dilution The optimal working dilution should be determined by the end user.
Formulation In PBS, pH 7.5 (50% glycerol, 0.01% thimerosal)
Gene NPPC
Gene Alias CNP
Gene Symbols NPPC
Host Species Rabbit
Immunogen A synthetic peptide (conjugated with KLH) corresponding to human NPPC.
Quantity 150 μg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 4880
Target Species Human
Content And Storage Store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Form Liquid
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.