Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

NUDCD1, Rabbit, Polyclonal Antibody, Abnova™

Rabbit polyclonal antibody raised against recombinant NUDCD1.

Manufacturer:  Abnova Corporation PAB21544

Catalog No. 89-123-039


Add to cart

Description

Description

Sequence: IKKNEGLTWPELVIGDKQGELIRDSAQCAAIAERLMHLTSEELNPNPDKEKPPCNAQELEECDIFFEESSSLCRFDGNTLKTTHVVNLGSNQYL
Specifications

Specifications

NUDCD1
Unconjugated
Immunohistochemistry (1:20-1:50) Western Blot (1:250-1:500) The optimal working dilution should be determined by the end user.
NUDCD1
CML66|FLJ14991
Rabbit
IgG
100 uL
Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Polyclonal
Human
Immunohistochemistry (PFA fixed), Western Blot
Rabbit polyclonal antibody raised against recombinant NUDCD1.
In PBS, pH 7.5 (40% glycerol, 0.02% sodium azide)
Liquid
NUDCD1
Recombinant protein corresponding to amino acids of human NUDCD1.
Antigen affinity purification
RUO
Primary
84955
SDS
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

For Research Use Only