Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 89123351

NUP107 Rabbit anti-Human, Polyclonal Antibody, Abnova™

Catalog No. 89123351 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-123-351 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-123-351 Supplier Abnova Corporation Supplier No. PAB21654

Description

Rabbit polyclonal antibody raised against recombinant NUP107.

This gene encodes a member of the nucleoporin family. The protein is localized to the nuclear rim and is an essential component of the nuclear pore complex (NPC). All molecules entering or leaving the nucleus either diffuse through or are actively transported by the NPC. Alternate transcriptional splice variants of this gene have been observed but have not been thoroughly characterized. [provided by RefSeq

Sequence: HLLRFMTHLILFFRTLGLQTKEEVSIEVLKTYIQLLIREKHTNLIAFYTCHLPQDLAVAQYALFLESVTEFEQRHHCLELAKEADLDVATITKTVVENIRKKDNGEFSHHDLAP

Specifications

Antigen NUP107
Applications Immunohistochemistry (PFA fixed)
Classification Polyclonal
Conjugate Unconjugated
Description Rabbit polyclonal antibody raised against recombinant NUP107.
Dilution Immunohistochemistry (1:10-1:20) The optimal working dilution should be determined by the end user.
Formulation In PBS, pH 7.5 (40% glycerol, 0.02% sodium azide)
Gene NUP107
Gene Alias NUP84
Gene Symbols NUP107
Host Species Rabbit
Immunogen Recombinant protein corresponding to amino acids of human NUP107.
Purification Method Antigen affinity purification
Quantity 100 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 57122
Target Species Human
Content And Storage Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Form Liquid
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.