Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

OR10S1, Rabbit, Polyclonal Antibody, Abnova™

Rabbit polyclonal antibody raised against recombinant OR10S1.

Supplier:  Abnova Corporation PAB28241

Catalog No. 89-129-747


Add to Cart

Description

Description

Olfactory receptors interact with odorant molecules in the nose, to initiate a neuronal response that triggers the perception of a smell. The olfactory receptor proteins are members of a large family of G-protein-coupled receptors (GPCR) arising from single coding-exon genes. Olfactory receptors share a 7-transmembrane domain structure with many neurotransmitter and hormone receptors and are responsible for the recognition and G protein-mediated transduction of odorant signals. The olfactory receptor gene family is the largest in the genome. The nomenclature assigned to the olfactory receptor genes and proteins for this organism is independent of other organisms. [provided by RefSeq

Sequence: MTSRSVCEKMTMTTENPNQTVVSHFFLEGLRYTAKHSSL
Specifications

Specifications

OR10S1
Polyclonal
Rabbit polyclonal antibody raised against recombinant OR10S1.
In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
OR11-279
Rabbit
Antigen affinity purification
RUO
219873
Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
IgG
Immunohistochemistry (PFA fixed)
Unconjugated
Immunohistochemistry (1:50-1:200) The optimal working dilution should be determined by the end user.
OR10S1
OR10S1
Recombinant protein corresponding to amino acids of recombinant OR10S1.
100 μL
Primary
Human
Liquid
Product Suggestions

Product Suggestions

SDS
Documents

Documents

Product Certifications
Promotions

Promotions

Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

For Research Use Only