OSBPL8, Rabbit, Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-129-916	100 μL

Catalog No. 89-129-916 Supplier Abnova Corporation Supplier No. PAB28410

Description

Rabbit polyclonal antibody raised against recombinant OSBPL8.

This gene encodes a member of the oxysterol-binding protein (OSBP) family, a group of intracellular lipid receptors. Like most members, the encoded protein contains an N-terminal pleckstrin homology domain and a highly conserved C-terminal OSBP-like sterol-binding domain. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq

Sequence: LDPLTGEWHYKFADTRPWDPLNDMIQFEKDGVIQTKVKHRTPMVSVPKMKHKPTRQQKKVAKGYSSPEPDIQDSSGSEAQSVKPSTRRKKGIELGDIQSSIESIKQTQEEIKRNIMALRNHLVSSTPATDY

Specifications

• Antigen: OSBPL8
• Applications: Immunofluorescence, Immunohistochemistry (PFA fixed)
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Rabbit polyclonal antibody raised against recombinant OSBPL8.
• Dilution: Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:200-1:500) Immunofluorescence (1-4 ug/ml) The optimal working dilution should be determined by the end user.
• Formulation: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
• Gene: OSBPL8
• Gene Alias: DKFZp686A11164/MGC126578/MGC133203/MST120/MSTP120/ORP8/OSBP10
• Gene Symbols: OSBPL8
• Host Species: Rabbit
• Immunogen: Recombinant protein corresponding to human OSBPL8.
• Purification Method: Antigen affinity purification
• Quantity: 100 μL
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 114882
• Target Species: Human
• Content And Storage: Store at 4 °C. For long term storage store at -20°C. Aliquot to avoid repeated freezing and thawing.
• Form: Liquid
• Isotype: IgG

For Research Use Only