p70 S6 Kinase/S6K Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP238448

Catalog No. NBP238448

Description

p70 S6 Kinase/S6K Polyclonal specifically detects p70 S6 Kinase/S6K in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin, Knockdown Validated.

Specifications

• Antigen: p70 S6 Kinase/S6K
• Classification: Polyclonal
• Dilution: Western Blot 0.4 ug/ml, Immunohistochemistry 1:50 - 1:200, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:50 - 1:200
• Gene Accession No.: P23443
• Gene Symbols: RPS6KB1
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: VSPVKFSPGDFWGRGASASTANPQTPVEYPMETSGIEQMDVTMSGEASAPLPIRQPNSGPYKKQAFPMISK
• Quantity: 0.1 mL
• Research Discipline: Autophagy, Cancer, mTOR Pathway, Protein Kinase, Signal Transduction
• Gene ID (Entrez): 6198
• Target Species: Human
• Isotype: IgG

• Applications: Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Alias: EC 2.7.11, EC 2.7.11.1, p70 ribosomal S6 kinase alpha, p70 S6 kinase alpha, p70 S6 kinase, alpha 1,70 kDa ribosomal protein S6 kinase 1, p70 S6 kinase, alpha 2, p70 S6KA, p70 S6K-alpha, p70(S6K)-alpha, p70-alpha, p70-S6K, P70S6K1, PS6K, ribosomal protein S6 kinase beta-1, Ribosomal protein S6 kinase I, ribosomal protein S6 kinase, 70kD, polypeptide 1, ribosomal protein S6 kinase, 70kDa, polypeptide 1, S6K, S6K1p70-S6K 1, S6K-beta-1, serine/threonine kinase 14 alpha, Serine/threonine-protein kinase 14A, STK14A
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.