PDE4D Rabbit anti-Human, Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-129-832	100 μL

Catalog No. 89-129-832 Supplier Abnova Corporation Supplier No. PAB28329

Description

Rabbit polyclonal antibody raised against recombinant PDE4D.

This gene encodes one of four mammalian counterparts to the fruit fly 'dunce' gene. The encoded protein has 3',5'-cyclic-AMP phosphodiesterase activity and degrades cAMP, which acts as a signal transduction molecule in multiple cell types. This gene uses different promoters to generate multiple alternatively spliced transcript variants that encode functional proteins

Sequence: FELTLEEDGESDTEKDSGSQVEEDTSCSDSKTLCTQDSESTEIPLDEQVEEEAVG

Specifications

• Antigen: PDE4D
• Applications: Immunofluorescence, Immunohistochemistry (PFA fixed)
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Rabbit polyclonal antibody raised against recombinant PDE4D.
• Dilution: Immunohistochemistry (1:200-1:500) Immunofluorescence (1-4 ug/ml) The optimal working dilution should be determined by the end user.
• Formulation: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
• Gene: PDE4D
• Gene Alias: DPDE3/HSPDE4D/PDE4DN2/STRK1
• Gene Symbols: PDE4D
• Host Species: Rabbit
• Immunogen: Recombinant protein corresponding to amino acids of recombinant PDE4D.
• Purification Method: Antigen affinity purification
• Quantity: 100 μL
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 5144
• Target Species: Human
• Content And Storage: Store at 4°C. For long term storage store at -20°C.
  Aliquot to avoid repeated freezing and thawing.
• Form: Liquid
• Isotype: IgG

For Research Use Only