Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

PDGFB Rabbit anti-Human, Mouse, Rat, Polyclonal Antibody, Abnova™

Catalog No. 89118070 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-118-070 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-118-070 Supplier Abnova Corporation Supplier No. PAB16179
Add to Cart
Add to Cart

Rabbit polyclonal antibody raised against PDGFB.

The protein encoded by this gene is a member of the platelet-derived growth factor family. The four members of this family are mitogenic factors for cells of mesenchymal origin and are characterized by a motif of eight cysteines. This gene product can exist either as a homodimer (PDGF-BB) or as a heterodimer with the platelet-derived growth factor alpha polypeptide (PDGF-AB), where the dimers are connected by disulfide bonds. Mutations in this gene are associated with meningioma. Reciprocal translocations between chromosomes 22 and 7, at sites where this gene and that for COL1A1 are located, are associated with a particular type of skin tumor called dermatofibrosarcoma protuberans resulting from unregulated expression of growth factor. Two alternatively spliced transcript variants encoding different isoforms have been identified for this gene. [provided by RefSeq

Sequence: IEIVRKKPIFKKATVTLEDHLACKCETVAAARPVTRSPGGSQEQRAKTPQTRVTI

Specifications

Antigen PDGFB
Applications ELISA, Immunohistochemistry, Western Blot
Classification Polyclonal
Conjugate Unconjugated
Description Rabbit polyclonal antibody raised against PDGFB.
Dilution ELISA (1-2 ug/mL) Western Blot (2-10 ug/mL) Immunohistochemistry (2-10 ug/mL) The optimal working dilution should be determined by the end user.
Formulation Lyophilized from PBS
Gene PDGFB
Gene Alias FLJ12858/PDGF2/SIS/SSV/c-sis
Gene Symbols PDGFB
Host Species Rabbit
Immunogen Human PDGFB.
Quantity 100 μg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 5155
Target Species Human, Mouse, Rat
Content And Storage Store at -20°C on dry atmosphere. After reconstitution with deionized water store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Form Lyophilized
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.