POLR2B, Rabbit, Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-124-823	100 μL

Catalog No. 89-124-823 Supplier Abnova Corporation Supplier No. PAB23123

Description

Rabbit polyclonal antibody raised against recombinant POLR2B.

This gene encodes the second largest subunit of RNA polymerase II, the polymerase responsible for synthesizing messenger RNA in eukaryotes. This subunit, in combination with at least two other polymerase subunits, forms a structure within the polymerase that maintains contact in the active site of the enzyme between the DNA template and the newly synthesized RNA. [provided by RefSeq

Sequence: FFRSVFYRSYKEQESKKGFDQEEVFEKPTRETCQGMRHAIYDKLDDDGLIAPGVRVSGDDVIIGKTVTLPENEDELESTNRRYTKRDCSTFLRTSE

Specifications

• Antigen: POLR2B
• Applications: Immunofluorescence, Immunohistochemistry (PFA fixed), Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Rabbit polyclonal antibody raised against recombinant POLR2B.
• Dilution: Immunohistochemistry (1:500-1:1000) Western Blot (1:250-1:500) Immunofluorescence (1-4 ug/mL) The optimal working dilution should be determined by the end user.
• Formulation: In PBS, pH 7.5 (40% glycerol, 0.02% sodium azide)
• Gene: POLR2B
• Gene Alias: POL2RB/RPB2/hRPB140/hsRPB2
• Gene Symbols: POLR2B
• Host Species: Rabbit
• Immunogen: Recombinant protein corresponding to amino acids of human POLR2B.
• Purification Method: Antigen affinity purification
• Quantity: 100 μL
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 5431
• Target Species: Human
• Content And Storage: Store at 4°C. For long term storage store at -20°C.
  Aliquot to avoid repeated freezing and thawing.
• Form: Liquid
• Isotype: IgG

For Research Use Only