Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

PPAN-P2RY11 Rabbit anti-Human, Polyclonal Antibody, Abnova™

Catalog No. 89129517 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-129-517 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-129-517 Supplier Abnova Corporation Supplier No. PAB28002
Add to Cart
Add to Cart

Rabbit polyclonal antibody raised against recombinant PPAN-P2RY11

The PPAN-P2RY11 mRNA is a naturally occurring read-through product, a result of intergenic splicing between adjacent genes, PPAN and P2RY11. The encoded fusion protein comprises of sequence sharing identity with each individual gene product. This transcript is found to be ubiquitously expressed and is upregulated by agents inducing granulocytic differentiation. However, its functional significance in vivo remains unclear. [provided by RefSeq

Sequence: RWEMDRGRGRLCDQKFPKTKDKSQGAQARRGPRGASRDGG

Specifications

Antigen PPAN-P2RY11
Applications Immunohistochemistry, Western Blot, Western Blot
Classification Polyclonal
Conjugate Unconjugated
Description Rabbit polyclonal antibody raised against recombinant PPAN-P2RY11
Dilution Immunohistochemistry (1:200 - 1:500) Western Blot (1:100 - 1:250) Immunoflurorescence (1-4 µg/ml) The optimal working dilution should be determined by the end user.
Formulation In PBS, pH 7.2, (40% glycerol, 0.02% sodium azide)
Gene PPAN-P2RY11
Gene Symbols PPAN-P2RY11
Host Species Rabbit
Immunogen Recombinant protein corresponding to amino acids of human PPAN-P2RY11
Purification Method Antigen affinity purification
Quantity 100 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 692312
Target Species Human
Content And Storage Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Form Liquid
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.