PPCS, Rabbit, Polyclonal Antibody, Abnova™

Rabbit polyclonal antibody raised against recombinant PPCS.

Manufacturer:  Abnova Corporation PAB22546

Catalog No. 89-124-254

Description

Biosynthesis of coenzyme A (CoA) from pantothenic acid (vitamin B5) is an essential universal pathway in prokaryotes and eukaryotes. PPCS (EC 6.3.2.5), one of the last enzymes in this pathway, converts phosphopantothenate to phosphopantothenoylcysteine (Daugherty et al., 2002 [PubMed 11923312]).[supplied by OMIM

Sequence: VLFLYRARSAFPYAHRFPPQTWLSALRPSGPALSGLLSLEAEENALPGFAEALRSYQEAAAAGTFLAVEFTTLADY

Specifications

• Antigen: PPCS
• Conjugate: Unconjugated
• Dilution: Immunohistochemistry (1:200-1:500) Western Blot (1:250-1:500) The optimal working dilution should be determined by the end user.
• Gene: PPCS
• Gene Alias: FLJ11838|MGC117357|MGC138220
• Host Species: Rabbit
• Isotype: IgG
• Quantity: 100 uL
• Storage Requirements: Store at 4°C. For long term storage store at -20°C.
  Aliquot to avoid repeated freezing and thawing.
• Monoclonal or Polyclonal: Polyclonal
• Target Species: Human

• Applications: Immunohistochemistry (PFA fixed), Western Blot
• Description: Rabbit polyclonal antibody raised against recombinant PPCS.
• Formulation: In PBS, pH 7.5 (40% glycerol, 0.02% sodium azide)
• Format: Liquid
• Gene Symbols: PPCS
• Immunogen: Recombinant protein corresponding to amino acids of human PPCS.
• Purification Method: Antigen affinity purification
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 79717

For Research Use Only