PPP4R4, Rabbit, Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-125-573	100 μL

Catalog No. 89-125-573 Supplier Abnova Corporation Supplier No. PAB23865

Description

Rabbit polyclonal antibody raised against recombinant PPP4R4.

The protein encoded by this gene is a HEAT-like repeat-containing protein. The HEAT repeat is a tandemly repeated, 37-47 amino acid long module occurring in a number of cytoplasmic proteins. Arrays of HEAT repeats form a rod-like helical structure and appear to function as protein-protein interaction surfaces. The repeat-containing region of this protein has some similarity to the constant regulatory domain of the protein phosphatase 2A PR65/A subunit. The function of this particular gene product has not been determined. Alternative splicing has been observed for this gene and two transcript variants encoding distinct isoforms have been identified. [provided by RefSeq

Sequence: SLFGYMEDLQELTIIERPVRRSLKTPEEIERLTVDEDLSDIERAVYLLSAGQDVQGTSVIANLPFLMRQNPTETLRRVLPKVR

Specifications

• Antigen: PPP4R4
• Applications: Immunofluorescence, Immunohistochemistry (PFA fixed), Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Rabbit polyclonal antibody raised against recombinant PPP4R4.
• Dilution: Immunohistochemistry (1:200-1:500) Western Blot (1:250-1:500) Immunofluorescence (1-4 ug/mL) The optimal working dilution should be determined by the end user.
• Formulation: In PBS, pH 7.5 (40% glycerol, 0.02% sodium azide)
• Gene: PPP4R4
• Gene Alias: KIAA1622/PP4R4
• Gene Symbols: PPP4R4
• Host Species: Rabbit
• Immunogen: Recombinant protein corresponding to amino acids of human PPP4R4.
• Purification Method: Antigen affinity purification
• Quantity: 100 μL
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 57718
• Target Species: Human
• Content And Storage: Store at 4°C. For long term storage store at -20°C.
  Aliquot to avoid repeated freezing and thawing.
• Form: Liquid
• Isotype: IgG

For Research Use Only