PRKAB2 Rabbit anti-Human, Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-129-792	100 μL

Catalog No. 89-129-792 Supplier Abnova Corporation Supplier No. PAB28286

Description

Rabbit polyclonal antibody raised against recombinant PRKAB2.

The protein encoded by this gene is a regulatory subunit of the AMP-activated protein kinase (AMPK). AMPK is a heterotrimer consisting of an alpha catalytic subunit, and noncatalytic beta and gamma subunits. AMPK is an important energy-sensing enzyme that monitors cellular energy status. In response to cellular metabolic stresses, AMPK is activated, and thus phosphorylates and inactivates acetyl-CoA carboxylase (ACC) and beta-hydroxy beta-methylglutaryl-CoA reductase (HMGCR), key enzymes involved in regulating de novo biosynthesis of fatty acid and cholesterol. This subunit may be a positive regulator of AMPK activity. It is highly expressed in skeletal muscle and thus may have tissue-specific roles. [provided by RefSeq

Sequence: MGNTTSDRVSGERHGAKAARSEGAGGHAPGKEHKIMVGSTDDPSVFSLPDSKLPGDKEFVSWQQDLEDSVKPTQQARPTVIRWSEGGKEVFISGSF

Specifications

• Antigen: PRKAB2
• Applications: Immunohistochemistry (PFA fixed), Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Rabbit polyclonal antibody raised against recombinant PRKAB2.
• Dilution: Immunohistochemistry (1:50-1:200) Western Blot (1:100-1:250) The optimal working dilution should be determined by the end user.
• Formulation: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
• Gene: PRKAB2
• Gene Alias: MGC61468
• Gene Symbols: PRKAB2
• Host Species: Rabbit
• Immunogen: Recombinant protein corresponding to amino acids of recombinant PRKAB2.
• Purification Method: Antigen affinity purification
• Quantity: 100 μL
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 5565
• Target Species: Human
• Content And Storage: Store at 4°C. For long term storage store at -20°C.
  Aliquot to avoid repeated freezing and thawing.
• Form: Liquid
• Isotype: IgG

For Research Use Only