Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

PTCD2, Rabbit, Polyclonal Antibody, Abnova™

Rabbit polyclonal antibody raised against recombinant PTCD2.

Supplier:  Abnova Corporation PAB28151

Catalog No. 89-129-659


Add to Cart

Description

Description

Sequence: KLNSPESFKICTTLREEALLKGEILSRRASCFAVALALNQNEMAKAVSIFSQIMNPESIACINLNIIIHIQSNMLENLIKTLK
Specifications

Specifications

PTCD2
Polyclonal
Rabbit polyclonal antibody raised against recombinant PTCD2.
In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
FLJ12598
Rabbit
Antigen affinity purification
RUO
79810
Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
IgG
Immunohistochemistry (PFA fixed), Western Blot
Unconjugated
Immunohistochemistry (1:50-1:200) Western Blot (1:100-1:250) The optimal working dilution should be determined by the end user.
PTCD2
PTCD2
Recombinant protein corresponding to amino acids of recombinant PTCD2.
100 μL
Primary
Human
Liquid
Recommendations

Recommendations

SDS
Documents

Documents

Product Certifications
Promotions

Promotions

Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

For Research Use Only