Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

R3hdm1, Rabbit, Polyclonal Antibody, Abnova™

Rabbit polyclonal antibody raised against partial recombinant R3hdm1.

Manufacturer:  Abnova Corporation PAB15706

Catalog No. 89-117-771


Add to cart

Description

Description

Sequence: YPLLGQPLQYNPPTLLHGHIPHQQGQSGSRHGNRGRRQAKKAASTDLGAGEAVVGKVLEITELPDGITRVEAEKLFGELFKIGAKIRWLRDPQSQPQLRRHALCCGSGDNTVNPEHSKPSDLASTYTVLATFPSISAAQSALKKQIHSVNKFKLRMSKKHYDFHILERASSQ
Specifications

Specifications

R3hdm1
Unconjugated
Western Blot (1:1000) The optimal working dilution should be determined by the end user.
R3hdm1
R3hdm
Rabbit
50 ug
Store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Polyclonal
Specific to recombinant protein GX0379. This antibody detects mR3HDM1 protein.
Western Blot
Rabbit polyclonal antibody raised against partial recombinant R3hdm1.
In PBS (50% glycerol, 0.02% sodium azide)
Liquid
R3hdm1
Recombinant GST fusion protein corresponding to 172 mouse R3hdm1.
RUO
Primary
226412
Mouse
SDS
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

For Research Use Only