Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 89117776

Rb1cc1, Rabbit, Polyclonal Antibody, Abnova™

Catalog No. 89117776 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
50 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-117-776 50 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-117-776 Supplier Abnova Corporation Supplier No. PAB15711
Add to Cart
Add to Cart

Description

Rabbit polyclonal antibody raised against partial recombinant Rb1cc1.

Sequence: QRLMSQSLSSVSSRHSEKIAIRDFQVGDLVLIILDERHDNYVLFTVSPTLYFLHSESLPALDLKPGEGASGASRRPWVLGKVMEKEYCQAKKAQNRFKVPLGTKFYRVKAVSWNKKV

Specifications

Antigen Rb1cc1
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Description Rabbit polyclonal antibody raised against partial recombinant Rb1cc1.
Dilution Western Blot (1:1000) The optimal working dilution should be determined by the end user.
Formulation In PBS (50% glycerol, 0.02% sodium azide)
Gene Rb1cc1
Gene Alias 2900055E04Rik/5930404L04Rik/Cc1/DRAGOU14/FIP200/LaXp180
Gene Symbols Rb1cc1
Host Species Rabbit
Immunogen Recombinant GST fusion protein corresponding to 117 mouse Rb1cc1.
Quantity 50 μg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 12421
Test Specificity Specific to recombinant protein GX0378. This antibody detects mRB1CC1 protein.
Target Species Mouse
Content And Storage Store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Form Liquid
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.